Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A5UFC5

Expression Region

1-234

Origin

Haemophilus influenzae (strain PittGG)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLTEKNTALEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTATN ALGLGLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQS LGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMALSLTILGALREIIGQGTI FEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS501493 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-01 20 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-02 60 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-03 120 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-04 200 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
Human NUDT17 activation kit by CRISPRa
GA116332 1 Kit

Human NUDT17 activation kit by CRISPRa

Sign In for Pricing
View Details