Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrus sinensis Chloroplast envelope membrane protein (cemA)

This Recombinant Citrus sinensis Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q09MG6

Expression Region

1-234

Origin

Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKNASIPLRYLSSIVFVVFLPWWIPLSFNKSLESWVTNWWNTSQSETFLNDIQEKAIL EKFIELEELFLLDEMIKEFPERRLEKLRIGLQKETIQLIKMHDEDHIHTIFHFSTNTICF VILSGYSILCNEELFILNSWVQEFLYNLSDTIKAFSILFVTDLCIGFHSPRGWELLIGYV YNDFGLAHNDNDIILSVLVSTFPVVLDTFFKYWLFSYLNRVSPSLVVIYHSMTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM5 Mouse Monoclonal Antibody [Clone ID: SPM551]
AM33275PU-S 100 µg

CEACAM5 Mouse Monoclonal Antibody [Clone ID: SPM551]

Sign In for Pricing
View Details
TRIML2 Antibody
KC-2343-01 50 μL

TRIML2 Antibody

Sign In for Pricing
View Details
TRIML2 Antibody
KC-2343-02 100 µL

TRIML2 Antibody

Sign In for Pricing
View Details
TRIML2 Antibody
KC-2343-03 1 mL

TRIML2 Antibody

Sign In for Pricing
View Details
Tazarotenic Acid
TRC-T010060-5MG 5 mg

Tazarotenic Acid

Sign In for Pricing
View Details
USP43 Human Gene Knockout Kit (CRISPR)
KN418571 1 Kit

USP43 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details