Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A5UBI7

Expression Region

1-235

Origin

Haemophilus influenzae (strain PittEE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTAT NALGLSLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQ SLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMALSLTILGALREIIGQGT IFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR3 / LARD Recombinant Rabbit monoclonal Antibody
HA723583 100 µL

DR3 / LARD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IMMP1L activation kit by CRISPRa
GA116265 1 Kit

Human IMMP1L activation kit by CRISPRa

Sign In for Pricing
View Details
FDX2 (NM_001031734) Human Recombinant Protein
TP309470 20 µg

FDX2 (NM_001031734) Human Recombinant Protein

Sign In for Pricing
View Details
Aldolase C (ALDOC) Human Gene Knockout Kit (CRISPR)
KN400333 1 Kit

Aldolase C (ALDOC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Leptin Receptor Antibody
KC-1837-01 50 μL

Leptin Receptor Antibody

Sign In for Pricing
View Details
Leptin Receptor Antibody
KC-1837-02 100 µL

Leptin Receptor Antibody

Sign In for Pricing
View Details