Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q57020

Expression Region

1-235

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTAT NALGLGLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQ SLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMALSLTILGALREIIGQGT IFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST6GALNAC4 Human Gene Knockout Kit (CRISPR)
KN402844 1 Kit

ST6GALNAC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS507953 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
CHD4 (3F2/4), CF740 conjugate, 0.1mg/mL
BNC743077-100 1x 100 µL

CHD4 (3F2/4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate
TRC-C555013-10MG 10 mg

2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate

Sign In for Pricing
View Details
Glutamate receptor 1 Recombinant Rabbit Monoclonal Antibody [SD2010]
ET1612-10 100 µL

Glutamate receptor 1 Recombinant Rabbit Monoclonal Antibody [SD2010]

Sign In for Pricing
View Details
ROM1 (NM_000327) Human Over-expression Lysate
LY424795 100 µg

ROM1 (NM_000327) Human Over-expression Lysate

Sign In for Pricing
View Details