Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q4QJQ3

Expression Region

1-235

Origin

Haemophilus influenzae (strain 86-028NP)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTAT NALGLGLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQ SLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMALSLTILGALREIIGQGT IFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amino-2-propanol
TRC-A628135-1G 1 g

1-Amino-2-propanol

Sign In for Pricing
View Details
P53 (Ab-6) Antibody
8B7185-AAT 50 µg

P53 (Ab-6) Antibody

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-01 24 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-02 48 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-03 96 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
1,4,5-Oxadiazepane Dihydrobromide
TRC-O444375-500MG 500 mg

1,4,5-Oxadiazepane Dihydrobromide

Sign In for Pricing
View Details