Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Derlin-3 (DERL3)

This Recombinant Human Derlin-3 (DERL3) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Derlin-3, Degradation in endoplasmic reticulum protein 3, DERtrin-3, Der1-like protein 3

UniProt

Q96Q80

Expression Region

1-235

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SD 0006
BUP09863-01 5 mg

SD 0006

Sign In for Pricing
View Details
SD 0006
BUP09863-02 10 mg

SD 0006

Sign In for Pricing
View Details
SD 0006
BUP09863-03 25 mg

SD 0006

Sign In for Pricing
View Details
SD 0006
BUP09863-04 50 mg

SD 0006

Sign In for Pricing
View Details
SD 0006
BUP09863-05 100 mg

SD 0006

Sign In for Pricing
View Details
SD 0006
BUP09863-06 200 mg

SD 0006

Sign In for Pricing
View Details