Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lymphocyte antigen 6G/LY6G, Mouse (P.pastoris, His-SUMO)

Lymphocyte antigen 6G/LY6G protein is uniquely expressed in bone marrow, indicating its involvement in the hematopoietic microenvironment. This suggests a role in regulating immune cell development or function within the bone marrow niche. Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris, His-SUMO) is the recombinant mouse-derived Lymphocyte antigen 6G/LY6G protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

CAS Number

9007-83-4

Product Name Alternative

Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris, His-SUMO), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lymphocyte-antigen-6g-ly6g-protein-mouse-p-pastoris.html

Purity

90.00

Smiles

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Molecular Formula

546644 (Gene_ID) P35461 (L27-G119) (Accession)

Molecular Weight

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCCHC9 Human qPCR Template Standard (NM_032280)
HK211324 1 Kit

ZCCHC9 Human qPCR Template Standard (NM_032280)

Sign In for Pricing
View Details
CRF1 (CRHR1) (NM_001145147) Human Tagged ORF Clone Lentiviral Particle
RC226896L4V 200 µL

CRF1 (CRHR1) (NM_001145147) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SULT1C4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45848061 1.0 µg DNA

SULT1C4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
APOBEC4 Protein Lysate (Rat) with C-HA Tag
12174036 100 µg

APOBEC4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Gag Antibody
orb843228 2 mg

Gag Antibody

Sign In for Pricing
View Details
IGHV1OR15-9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1035405 3x 1.0 µg

IGHV1OR15-9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details