Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD81 antigen (CD81)

This Recombinant Bovine CD81 antigen (CD81) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

CD81 antigen, CD_antigen= CD81

UniProt

Q3ZCD0

Expression Region

1-236

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDRPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAIVDDDANNAKAVVKTFHETLNCCGSNTLMTLTTSVLKNSLCPSSGN VITNLFKEDCHGKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GAS2 shRNA Plasmid
abx951736-01 150 µg

Human GAS2 shRNA Plasmid

Sign In for Pricing
View Details
Human GAS2 shRNA Plasmid
abx951736-02 300 µg

Human GAS2 shRNA Plasmid

Sign In for Pricing
View Details
SYDE2 Rabbit Polyclonal Antibody (FITC)
orb2087667 100 µL

SYDE2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CCDC97 Antibody (FITC)
orb354317-01 50 µg

CCDC97 Antibody (FITC)

Sign In for Pricing
View Details
CCDC97 Antibody (FITC)
orb354317-02 100 µg

CCDC97 Antibody (FITC)

Sign In for Pricing
View Details
Ag85A
PT-A00117-01 2 µg

Ag85A

Sign In for Pricing
View Details