Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein YIPF6 (Yipf6)

This Recombinant Rat Protein YIPF6 (Yipf6) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

Q4QQU5

Expression Region

1-236

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAEDSPGEQEATSSKPLFAGLSDVSISQDIPIEGEITIPSGTRAQECDSSTLNESIRR TIMRDLKAVGRKFMHVLYPRKSNTLLRDWDLWGPLILCVSLALMLQKSSVEGKRDGGSPE FAEVFVIIWFGAVTITLNSKLLGGNISFFQSLCVLGYCVLPLNIAMLICRLLLLAGQGPI NFMIRLFVVLVMFAWSVIASTAFLADCQPPNRKALAVYPVFLFYFVVSWMILTFTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bloom Syndrome, phosphorylated (Thr99)
307998 100 µL

Bloom Syndrome, phosphorylated (Thr99)

Sign In for Pricing
View Details
Anti-C-Myc Antibody (Rabbit) - HRP Conjugated
RMYC-45P-Z 0.1 mg

Anti-C-Myc Antibody (Rabbit) - HRP Conjugated

Sign In for Pricing
View Details
RSRC2, NT (RSRC2, Arginine/serine-rich coiled-coil protein 2) (MaxLight 650)
MBS6344257-01 0.1 mL

RSRC2, NT (RSRC2, Arginine/serine-rich coiled-coil protein 2) (MaxLight 650)

Sign In for Pricing
View Details
RSRC2, NT (RSRC2, Arginine/serine-rich coiled-coil protein 2) (MaxLight 650)
MBS6344257-02 5x 0.1 mL

RSRC2, NT (RSRC2, Arginine/serine-rich coiled-coil protein 2) (MaxLight 650)

Sign In for Pricing
View Details
SUHW2 (ZNF280B) (NM_080764) Human Untagged Clone
SC305834 10 µg

SUHW2 (ZNF280B) (NM_080764) Human Untagged Clone

Sign In for Pricing
View Details
PDILT (NM_174924) Human Recombinant Protein
TP306717M 100 µg

PDILT (NM_174924) Human Recombinant Protein

Sign In for Pricing
View Details