Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein YIPF6 (Yipf6)

This Recombinant Rat Protein YIPF6 (Yipf6) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

Q4QQU5

Expression Region

1-236

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAEDSPGEQEATSSKPLFAGLSDVSISQDIPIEGEITIPSGTRAQECDSSTLNESIRR TIMRDLKAVGRKFMHVLYPRKSNTLLRDWDLWGPLILCVSLALMLQKSSVEGKRDGGSPE FAEVFVIIWFGAVTITLNSKLLGGNISFFQSLCVLGYCVLPLNIAMLICRLLLLAGQGPI NFMIRLFVVLVMFAWSVIASTAFLADCQPPNRKALAVYPVFLFYFVVSWMILTFTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax CRISPR All-in-one AAV vector set (with saCas9)(Human)
13026151 3x 1.0 µg DNA

Bax CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit Monoclonal IGFBP-3 Antibody (010) [DyLight 488]
NBP2-89496G 0.1 mL

Rabbit Monoclonal IGFBP-3 Antibody (010) [DyLight 488]

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni rpsD Protein (aa 1-208) (strain 81116 / NCTC 11828)
VAng-Ly2396-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni rpsD Protein (aa 1-208) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details
Trim21 (NM_001082572) Rat Tagged ORF Clone Lentiviral Particle
RR202825L4V 200 µL

Trim21 (NM_001082572) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZDHHC11 AAV Vector (Mouse) (CMV)
50779104 1 µg

ZDHHC11 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rabbit Claudin 5 ELISA Kit
MBS065997-01 48 Well

Rabbit Claudin 5 ELISA Kit

Sign In for Pricing
View Details