Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIPF6 (YIPF6)

This Recombinant Human Protein YIPF6 (YIPF6) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

Q96EC8

Expression Region

1-236

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRN TIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQF AEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVN FMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5BL1P 3'UTR Luciferase Stable Cell Line
TU016615 1.0 mL

OR5BL1P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DCT, NT (DCT, TYRP2, L-dopachrome tautomerase, L-dopachrome Delta-isomerase, Tyrosinase-related protein 2) (AP) discontinued
034517-AP 200 µL

DCT, NT (DCT, TYRP2, L-dopachrome tautomerase, L-dopachrome Delta-isomerase, Tyrosinase-related protein 2) (AP) discontinued

Sign In for Pricing
View Details
CpCp, S pack
JBS-NU-441S 150 μL

CpCp, S pack

Sign In for Pricing
View Details
Substance P
TP1087-01 1 mg

Substance P

Sign In for Pricing
View Details
Substance P
TP1087-02 5 mg

Substance P

Sign In for Pricing
View Details
Substance P
TP1087-03 10 mg

Substance P

Sign In for Pricing
View Details