Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIPF6 (YIPF6)

This Recombinant Human Protein YIPF6 (YIPF6) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

Q96EC8

Expression Region

1-236

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRN TIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQF AEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVN FMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXK1 Rabbit Polyclonal Antibody (Cy5)
orb944432 100 µL

FOXK1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
KMT1B/SUV39H2 Rabbit Polyclonal Antibody (HRP)
orb2601265 100 µg

KMT1B/SUV39H2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
anti-hTNFR1 VHH antibody
JOT0005-1-50 50

anti-hTNFR1 VHH antibody

Sign In for Pricing
View Details
AP4B1 Rabbit Polyclonal Antibody (Biotin)
orb2088178 100 µL

AP4B1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Double tray HxDxW 170x680x139mm, 2 trays w/ handel and lid
TE29350 1 Piece

Double tray HxDxW 170x680x139mm, 2 trays w/ handel and lid

Sign In for Pricing
View Details
Alarin (del/E3, Galanin-like Peptide, GALP) (Carboxyfluorescein)
MBS644464-01 0.1 mL

Alarin (del/E3, Galanin-like Peptide, GALP) (Carboxyfluorescein)

Sign In for Pricing
View Details