Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9MUN7

Expression Region

1-236

Origin

Mesostigma viride

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINNQESLRSQTFFCIKYIISLSFFFILIYQLLNFLVLRPYAEYLWNHYQTDVFLNSSQE ERIFAKLQNFEEEMQFDMLISYTYPLNPQVLHKEMEEKAFELAHMSNNESINSIAHVFTD LLIAFLIFCLLINAKKEIAIIQTYIDQYIYSLTDAKKSFFLILFTDIFVGFHSSHGWKIL IELCLTHLGLPENKGFIFLFVATFPVILDTLFKYWIFLYLNRISPSAVATFNNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tnfsf11 Pre-designed siRNA Set A
SI214959A 1 Each

Rat Tnfsf11 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NAE1, ID (NAE1, APPBP1, NEDD8-activating enzyme E1 regulatory subunit, Amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, Proto-oncogene protein 1) (Azide free) (HRP) discontinued
038779-HRP 200 µL

NAE1, ID (NAE1, APPBP1, NEDD8-activating enzyme E1 regulatory subunit, Amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, Proto-oncogene protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
HIVEP1 Rabbit pAb, AP conjugated
orb2858393 100 µL

HIVEP1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
C4B Protein Vector (Mouse) (pPB-C-His)
PV160546 500 ng

C4B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
PZP Antibody, HRP conjugated
A32558-50UG 50 µg

PZP Antibody, HRP conjugated

Sign In for Pricing
View Details
2- (4-Hydroxy-3-methylphenyl) acetonitrile
YCA65324-01 50 mg

2- (4-Hydroxy-3-methylphenyl) acetonitrile

Sign In for Pricing
View Details