What is the catalog number for Recombinant Saguinus oedipus CD81 protein (CD81)?

The catalog number for Recombinant Saguinus oedipus CD81 protein (CD81) is orb2917464.

What sizes are available for Recombinant Saguinus oedipus CD81 protein (CD81)?

Recombinant Saguinus oedipus CD81 protein (CD81) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Saguinus oedipus CD81 protein (CD81) come in?

Recombinant Saguinus oedipus CD81 protein (CD81) is available in 2 different pack sizes.

Is Recombinant Saguinus oedipus CD81 protein (CD81) in stock?

Recombinant Saguinus oedipus CD81 protein (CD81) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Saguinus oedipus CD81 protein (CD81)

This Recombinant Saguinus oedipus CD81 protein (CD81) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

CD81 protein, CD_antigen= CD81

UniProt

Q9N0J9

Expression Region

1-236

Origin

Saguinus oedipus (Cotton-top tamarin)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLNCCGSSTLSALTTSMLKNNLCPSGSS IISNLFKEDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY