Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD63 antigen (CD63)

This Recombinant Bovine CD63 antigen (CD63) spans the amino acid sequence from region 2-237.

Product Specifications

Product Name Alternative

CD63 antigen, CD_antigen= CD63

UniProt

Q9XSK2

Expression Region

2-237

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLVFCACAVGLIAVGVGTHLVLNQTITHGATPSFLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVRSEFNKDFRQ QMKNYPKDNQTASILDKMQKDFECCGAANYTDWEKILAVTNKVPDSCCVNITHNCGINFV VKDIHTEGCVEKIAAWLRKNVLVVAAAALGIAFVEILGIVLACCLVKSIRSGYEVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-4654 Vector
mh31580 500 ng

LentimiRa-Off-hsa-miR-4654 Vector

Sign In for Pricing
View Details
Phosphate Buffered Saline Tablet, 1L Tablet
PBS02-010 10 Tab

Phosphate Buffered Saline Tablet, 1L Tablet

Sign In for Pricing
View Details
Renin Rabbit mAb
E60M3435 100 µL

Renin Rabbit mAb

Sign In for Pricing
View Details
Human Cadherin, Osteoblast (CDHOB) ELISA Kit
BSKH61931-01 48 Tests

Human Cadherin, Osteoblast (CDHOB) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin, Osteoblast (CDHOB) ELISA Kit
BSKH61931-02 96 Tests

Human Cadherin, Osteoblast (CDHOB) ELISA Kit

Sign In for Pricing
View Details
FGF7 / FGF-7 / KGF Protein (His Tag)
M60-094-L50 50 µg

FGF7 / FGF-7 / KGF Protein (His Tag)

Sign In for Pricing
View Details