Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD63 antigen (CD63)

This Recombinant Bovine CD63 antigen (CD63) spans the amino acid sequence from region 2-237.

Product Specifications

Product Name Alternative

CD63 antigen, CD_antigen= CD63

UniProt

Q9XSK2

Expression Region

2-237

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLVFCACAVGLIAVGVGTHLVLNQTITHGATPSFLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVRSEFNKDFRQ QMKNYPKDNQTASILDKMQKDFECCGAANYTDWEKILAVTNKVPDSCCVNITHNCGINFV VKDIHTEGCVEKIAAWLRKNVLVVAAAALGIAFVEILGIVLACCLVKSIRSGYEVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MgsA Polyclonal Antibody
A56238-100 100 µL

MgsA Polyclonal Antibody

Sign In for Pricing
View Details
Snx19 sgRNA CRISPR Lentivector set (Mouse)
K3185601 3x 1.0 µg

Snx19 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
NGFR/p75NTR Rabbit pAb, IRDye 800CW conjugated
orb2882633 100 µL

NGFR/p75NTR Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
WNT1 Human shRNA Plasmid Kit (Locus ID 7471)
TR308365 1 Kit

WNT1 Human shRNA Plasmid Kit (Locus ID 7471)

Sign In for Pricing
View Details
Abce1 Rat shRNA Plasmid (Locus ID 361390)
TL706982 1 Kit

Abce1 Rat shRNA Plasmid (Locus ID 361390)

Sign In for Pricing
View Details
RSAD2 Protein Vector (Rat) (pPM-C-HA)
42766026 500 ng

RSAD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details