What is the catalog number for Recombinant Bovine Protein YIPF6 (YIPF6)?

The catalog number for Recombinant Bovine Protein YIPF6 (YIPF6) is orb2917462.

What sizes are available for Recombinant Bovine Protein YIPF6 (YIPF6)?

Recombinant Bovine Protein YIPF6 (YIPF6) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Bovine Protein YIPF6 (YIPF6) come in?

Recombinant Bovine Protein YIPF6 (YIPF6) is available in 2 different pack sizes.

Is Recombinant Bovine Protein YIPF6 (YIPF6) in stock?

Recombinant Bovine Protein YIPF6 (YIPF6) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Bovine Protein YIPF6 (YIPF6)

This Recombinant Bovine Protein YIPF6 (YIPF6) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

A6QLC6

Expression Region

1-236

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAVESPGDPGTTTPRPLFAGLSDISISQDIPVEGEITIPVRSRVREFDSSTLNESVQN TIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRGSVDSEKDGGPQF AEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTMAMLVCRLVLLAEPGPVN FMVRLFVVIIMFAWSIVASTAFLADSQPPNRKALAVYPVFLFYFVISWMILTFTPQ