Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus megaterium ATP synthase subunit a (atpB)

This Recombinant Bacillus megaterium ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P20600

Expression Region

1-236

Origin

Bacillus megaterium (strain ATCC 12872 / QMB1551)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHESPTIEFLGLTFSQSNLLMVTVASVIVFLIAVLCTRTLAMKPSGAQNFIEWVLDFVK GLVNSNMDWKTGGRFLTLGVTLLMYIFVSNMLGLPFAIVIDHNLWWKSPTADPAITLTLA VMVVVLSHYYGIKMRGFSAYTKDYFKPMAFLFPLKIIEEFANTLTLGLRLYGNIYAGEIL LSLLAGLATTGFLGTIGAAIPMLLWQGFSIFVGAIQAFIFTMLTMVYLSHKVSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG21 (NM_001127890) Human Over-expression Lysate
LC426877 20 µg

SPG21 (NM_001127890) Human Over-expression Lysate

Sign In for Pricing
View Details
PACSIN1 (N-term) Rabbit Polyclonal Antibody
AP15037PU-N 400 µL

PACSIN1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL
BNCB2240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Staphylococcus aureus TaqMan PCR Kit
TM29350 100 Reactions

Staphylococcus aureus TaqMan PCR Kit

Sign In for Pricing
View Details
Hsp27 Antibody
OC-765-01 50 μL

Hsp27 Antibody

Sign In for Pricing
View Details
Hsp27 Antibody
OC-765-02 100 µL

Hsp27 Antibody

Sign In for Pricing
View Details