Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anoxybacillus flavithermus ATP synthase subunit a (atpB)

This Recombinant Anoxybacillus flavithermus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B7GMF9

Expression Region

1-236

Origin

Anoxybacillus flavithermus (strain DSM 21510 / WK1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHHEAPLYTWFGLTFNLANVLMITVTSVIVFVIAVLATRNLAMKPTGMQNFLEWVMDFVK GIIKSNMDWKTGGRFHMLGMTLIMYIFVANMLGLPFSVVIDNKLWWKSPTADPVVTLTLA TMVVALSHYYGIKLNGFKEYAKGFVSPMPILFPLKIIEEFANTLTLGLRLYGNIFAGEIL LALLAGSLATGVGGTIAAIIPTIAWQGFSIFVGAIQAFIFTMLTMVYMAHKVSHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC8 antibody
MBS9401259-01 0.1 mL

RIC8 antibody

Sign In for Pricing
View Details
RIC8 antibody
MBS9401259-02 5x 0.1 mL

RIC8 antibody

Sign In for Pricing
View Details
XpressTM Human PVRL1 Over-expressing Cell Line (293T)
ABC-X0264C 1 Vial

XpressTM Human PVRL1 Over-expressing Cell Line (293T)

Sign In for Pricing
View Details
anti-human CD79b-R-PE
MBS666501-01 120 Tests

anti-human CD79b-R-PE

Sign In for Pricing
View Details
anti-human CD79b-R-PE
MBS666501-02 5x 120 Tests

anti-human CD79b-R-PE

Sign In for Pricing
View Details
Recombinant Bordetella bronchiseptica Putative 5'(3')-deoxyribonucleotidase (BB0433)
MBS1436698-01 0.02 mg (E-Coli)

Recombinant Bordetella bronchiseptica Putative 5'(3')-deoxyribonucleotidase (BB0433)

Sign In for Pricing
View Details