Recombinant Anoxybacillus flavithermus ATP synthase subunit a (atpB)
This Recombinant Anoxybacillus flavithermus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-236.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
B7GMF9
Expression Region
1-236
Origin
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHHEAPLYTWFGLTFNLANVLMITVTSVIVFVIAVLATRNLAMKPTGMQNFLEWVMDFVK GIIKSNMDWKTGGRFHMLGMTLIMYIFVANMLGLPFSVVIDNKLWWKSPTADPVVTLTLA TMVVALSHYYGIKLNGFKEYAKGFVSPMPILFPLKIIEEFANTLTLGLRLYGNIFAGEIL LALLAGSLATGVGGTIAAIIPTIAWQGFSIFVGAIQAFIFTMLTMVYMAHKVSHDH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
143670-01 50 µg
SCF (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, Kitlg) discontinued
Sign In for Pricing
View Details 143670-02 100 µg
SCF (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, Kitlg) discontinued
Sign In for Pricing
View Details 
GTR15384257 1 Vial
Lentiviral human IMMT sgRNA gene knockout kit - Lentiviral human IMMT sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details