Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-8 (TSPAN8)

This Recombinant Pongo abelii Tetraspanin-8 (TSPAN8) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Tetraspanin-8, Tspan-8

UniProt

Q5R9S6

Expression Region

1-237

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVSGCIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQEIFSSEDVGSSSYVAVDILI AVGAIIMILGFLGCCGAIKESPCMLLLFFIGLLLILLLQVTAGILGAVFKSGSDRIVNET LYENTKLLSATGESEQQFQEGIIALQKEFKCCGLVNGAADWGNNFQKYPELCDCLDKQRP CQSYNGKEVYKEPCIPFIKDFLAKNLIIVIGIAFGLAVIEILGLVFSMVLYCQIGNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXIM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
23225061 1.0 µg DNA

HEXIM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pard6b AAV siRNA Pooled Vector
36009166 1.0 µg

Pard6b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NTRK2 Antibody
E19-6823 100 µg -100 µL

NTRK2 Antibody

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3242), CF647 conjugate, 0.1mg/mL
BNC473242-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3242), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Quaterphenyl
MBS5783735 Inquire

Quaterphenyl

Sign In for Pricing
View Details
SULT6B1 siRNA (Human)
MBS828827-01 15 nmol

SULT6B1 siRNA (Human)

Sign In for Pricing
View Details