Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD63 antigen (CD63)

This Recombinant Cat CD63 antigen (CD63) spans the amino acid sequence from region 2-238.

Product Specifications

Product Name Alternative

CD63 antigen, CD_antigen= CD63

UniProt

Q76B49

Expression Region

2-238

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLRQTIVQGATPGSLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMVTFAIFLSLIMLVEVAVAIAGYVFRDKVMSEFNKDFRQ QMQNYPKNNHTVSIVDRMQEDFKCCGAANYTDWGSIPLMSKARVPDSCCVNVTQGCGISF KVKEIHEEGCVEKIGGWLRSNVLVVAAAALGIAFVEVLGIIFACCLVKSIRSGYEVM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833M1-01 25 µg

Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833M1-02 100 µg

Elab Fluor® 700 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Rat D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit
EK13590 48 Tests

Rat D Site Of Albumin Promoter Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Tuberculostearic Acid Methyl-d3 Ester
468354 2.5 mg

Tuberculostearic Acid Methyl-d3 Ester

Sign In for Pricing
View Details
EIF3FP1 3'UTR Lenti-reporter-Luc Vector
19117081 1.0 µg

EIF3FP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DR1 CRISPR Knock Out 293T Cell Line (Human)
18588141 1x 10^6 Cells / 1.0 mL

DR1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details