Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD63 antigen (CD63)

This Recombinant Cat CD63 antigen (CD63) spans the amino acid sequence from region 2-238.

Product Specifications

Product Name Alternative

CD63 antigen, CD_antigen= CD63

UniProt

Q76B49

Expression Region

2-238

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLRQTIVQGATPGSLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMVTFAIFLSLIMLVEVAVAIAGYVFRDKVMSEFNKDFRQ QMQNYPKNNHTVSIVDRMQEDFKCCGAANYTDWGSIPLMSKARVPDSCCVNVTQGCGISF KVKEIHEEGCVEKIGGWLRSNVLVVAAAALGIAFVEVLGIIFACCLVKSIRSGYEVM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAN Domain Containing 1 (SCAND1) Antibody
abx006122-01 20 µL

SCAN Domain Containing 1 (SCAND1) Antibody

Sign In for Pricing
View Details
SCAN Domain Containing 1 (SCAND1) Antibody
abx006122-02 100 µL

SCAN Domain Containing 1 (SCAND1) Antibody

Sign In for Pricing
View Details
SCAN Domain Containing 1 (SCAND1) Antibody
abx006122-03 2x 100 µL

SCAN Domain Containing 1 (SCAND1) Antibody

Sign In for Pricing
View Details
Anti-Zebrafish FABP4A Antibody Picoband® Cy3 Conjugated
AZQ66I80-Cy3 100 µg/Vial

Anti-Zebrafish FABP4A Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human CD85g/LILRA4 Protein, C-His
E55P3997 50 µg

Recombinant Human CD85g/LILRA4 Protein, C-His

Sign In for Pricing
View Details
MAGEA6 Rabbit Polyclonal Antibody (Cy5)
orb955305 100 µL

MAGEA6 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details