What is the catalog number for Recombinant Human Tetraspanin-8 (TSPAN8)?

The catalog number for Recombinant Human Tetraspanin-8 (TSPAN8) is orb2917438.

What sizes are available for Recombinant Human Tetraspanin-8 (TSPAN8)?

Recombinant Human Tetraspanin-8 (TSPAN8) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Human Tetraspanin-8 (TSPAN8) come in?

Recombinant Human Tetraspanin-8 (TSPAN8) is available in 2 different pack sizes.

Is Recombinant Human Tetraspanin-8 (TSPAN8) in stock?

Recombinant Human Tetraspanin-8 (TSPAN8) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human Tetraspanin-8 (TSPAN8)

This Recombinant Human Tetraspanin-8 (TSPAN8) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Tetraspanin-8, Tspan-8, Transmembrane 4 superfamily member 3, Tumor-associated antigen CO-029

UniProt

P19075

Expression Region

1-237

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILI AVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNET LYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRP CQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK