Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD63 antigen (Cd63)

This Recombinant Rat CD63 antigen (Cd63) spans the amino acid sequence from region 2-238.

Product Specifications

Product Name Alternative

CD63 antigen, Mast cell antigen AD1, CD_antigen= CD63

UniProt

P28648

Expression Region

2-238

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQK QMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDF KESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYEVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP1 Antibody
A47188-100UL 100 µL

VAMP1 Antibody

Sign In for Pricing
View Details
NR2F1 Antibody, Biotin conjugated
A30012-100UG 100 µg

NR2F1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse PLA2G1B protein
orb707266-01 10 µg

Mouse PLA2G1B protein

Sign In for Pricing
View Details
Mouse PLA2G1B protein
orb707266-02 50 µg

Mouse PLA2G1B protein

Sign In for Pricing
View Details
Mouse PLA2G1B protein
orb707266-03 500 µg

Mouse PLA2G1B protein

Sign In for Pricing
View Details
STRAP Rabbit pAb
E45R26228N-100 100 µL

STRAP Rabbit pAb

Sign In for Pricing
View Details