Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P41013

Expression Region

1-237

Origin

Bacillus caldotenax

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHKAPLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVR GIINSTMDWQTGGRFLTLGVTLIMYVFVANMLGLPFWLDVTVNFGGNRRPTDATVTLTLR DGRRPHHYYGVKMKGASDYLRDYTRPVAWLFPLKIIEEFANTLTLGLRLFGNIYAGEILL GLLASLGTHYGVLGCGSIPMMVIMVWQAFSIFVGTIQAFIFTMLTSFYMAHKISHDH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAX1 Protein Lysate
OCOA03954-20UG 20 µg

VAX1 Protein Lysate

Sign In for Pricing
View Details
SFRP5 (NM_003015) Human Tagged ORF Clone Lentiviral Particle
RC208391L1V 200 µL

SFRP5 (NM_003015) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-Chloro-N- (naphthalen-1-ylmethyl) acetamide
OR1044651-01 100 mg

2-Chloro-N- (naphthalen-1-ylmethyl) acetamide

Sign In for Pricing
View Details
2-Chloro-N- (naphthalen-1-ylmethyl) acetamide
OR1044651-02 250 mg

2-Chloro-N- (naphthalen-1-ylmethyl) acetamide

Sign In for Pricing
View Details
2-Chloro-N- (naphthalen-1-ylmethyl) acetamide
OR1044651-03 1 g

2-Chloro-N- (naphthalen-1-ylmethyl) acetamide

Sign In for Pricing
View Details
Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)
abx304965-01 20 µg

Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)

Sign In for Pricing
View Details