Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Histidine transport system permease protein hisM (hisM)

This Recombinant Histidine transport system permease protein hisM (hisM) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Histidine transport system permease protein hisM

UniProt

P0AEU6

Expression Region

1-238

Origin

Shigella flexneri

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIW LFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEI FAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTA TVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF488A conjugate, 0.1mg/mL
BNC882174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details