Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE)

This Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B7UVW8

Expression Region

1-238

Origin

Pseudomonas aeruginosa (strain LESB58)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQDFREIARNGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATMLVLACSNAAVSL VRGAVSEAIRLPAFVMIIAVLTTCIELLMQAWTYELYQVLGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLMGLGFALVLLVLGGLRELLGQGTLLADMHLLFGPAAADWKIQPFP QYQGFLLAILPPGAFIMLGLLIALKNRIDESLAERAKVQAGDVPATQRQRVRVTGVIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Antibody
KC-6263-01 50 μL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
KC-6263-02 100 µL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
KC-6263-03 1 mL

STAT3 Antibody

Sign In for Pricing
View Details
GALNT17 (NM_022479) Human Over-expression Lysate
LC402927 20 µg

GALNT17 (NM_022479) Human Over-expression Lysate

Sign In for Pricing
View Details
Aldh3b2 Mouse Gene Knockout Kit (CRISPR)
KN501122 1 Kit

Aldh3b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KDM5D (NM_001146705) Human Over-expression Lysate
LC432108 20 µg

KDM5D (NM_001146705) Human Over-expression Lysate

Sign In for Pricing
View Details