Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 9

This Recombinant Picea sitchensis CASP-like protein 9 spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

CASP-like protein 9

UniProt

B8LQF9

Expression Region

1-238

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSTYPRRRFDEVFLVEISSRILVTQEKHQQEEEEKKVRMAGKANVSVLMSEDASFHQK VAVEKRLKIGEVILRFAMIALALVAAVRVGTDTQTRTIFTIEKKAKYSDMKALVFLVVMN GIVASYSLLQGLRCVLSIYTQSPLTSKPLAWLIFALDQTMAYFSLAAAAAAAESAYLAER GQTEFQWMKVCIFYEKFCHQIGEGLVSTFLVSLSMATVSGMSAYHLFRLYGSKGKSIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2’-Dibenzothiazoyl Disulfide
TRC-D417020-250G 250 g

2,2’-Dibenzothiazoyl Disulfide

Sign In for Pricing
View Details
Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit
MBS9321743-01 48 Well

Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit
MBS9321743-02 96 Well

Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit
MBS9321743-03 5x 96 Well

Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit
MBS9321743-04 10x 96 Well

Mouse Pleckstrin homology domain-containing family M member 2 (PLEKHM2) ELISA Kit

Sign In for Pricing
View Details
USP48 Peptide
MBS3232502-01 0.1 mg

USP48 Peptide

Sign In for Pricing
View Details