Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M12 ATP synthase subunit a (atpB)

This Recombinant Streptococcus pyogenes serotype M12 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1JCL8

Expression Region

1-238

Origin

Streptococcus pyogenes serotype M12 (strain MGAS2096)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFV DGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLA LSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEV VTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFTKLTATYLGKKVNESEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -Prunasin Tetraacetate
MBS6019434-01 25 mg

(R) -Prunasin Tetraacetate

Sign In for Pricing
View Details
(R) -Prunasin Tetraacetate
MBS6019434-02 5x 25 mg

(R) -Prunasin Tetraacetate

Sign In for Pricing
View Details
SLC3A2 Peptide
DF7468-BP 1 mg

SLC3A2 Peptide

Sign In for Pricing
View Details
IGF BP7 protein
30R-AI120 25 ug

IGF BP7 protein

Sign In for Pricing
View Details
Mouse C57 Embryo-E17 Total Protein
MT-104-17-C57 1 mg

Mouse C57 Embryo-E17 Total Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS541476 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details