Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M12 ATP synthase subunit a (atpB)

This Recombinant Streptococcus pyogenes serotype M12 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1JMJ4

Expression Region

1-238

Origin

Streptococcus pyogenes serotype M12 (strain MGAS9429)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFV DGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLA LSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEV VTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFTKLTATYLGKKVNESEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hopx (NM_175606) Mouse Untagged Clone
MC201799 10 µg

Hopx (NM_175606) Mouse Untagged Clone

Sign In for Pricing
View Details
COVID-19 Spike Glycoprotein-S2
32-6254-50 50 µg

COVID-19 Spike Glycoprotein-S2

Sign In for Pricing
View Details
6-Bromo-3’-nitroflavone
TRC-B686235-250MG 250 mg

6-Bromo-3’-nitroflavone

Sign In for Pricing
View Details
Cesium (Cs) ICP Standard Solution 1.0 gm/L In 0.1% HNO3 Traceable To NIST-1000 ppm-0.1% v/v Nitric Acid
ICP44 00125 125 mL

Cesium (Cs) ICP Standard Solution 1.0 gm/L In 0.1% HNO3 Traceable To NIST-1000 ppm-0.1% v/v Nitric Acid

Sign In for Pricing
View Details
GCNT3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV670881 1.0 µg DNA

GCNT3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Omadacycline
MBS5751633 Inquire

Omadacycline

Sign In for Pricing
View Details