Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Tetraspanin-8 (TSPAN8)

This Recombinant Bovine Tetraspanin-8 (TSPAN8) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Tetraspanin-8, Tspan-8

UniProt

Q2KIS9

Expression Region

1-238

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVNVCIKCSMFIFNFVFWLCGAIILSVAISIRAGKIGQEILAPGDADLNLFIAVNILI FVGAVIMILGFLGCCGAMKENQFMMILFFVGLLMILLLQVAAGIVATTRKSKTEQALNKT LLINARLLSSTDENERVFQKAFSELQEELKCCGLVNGASDWGSNFQHYYRTCECPSESDS SCTKYSGKTIYKQSCFASISQMFSKRLFIVLALAFGLAAIEVLGLIFSIVLYCQMRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF488A conjugate, 0.1mg/mL
BNC880600-100 1x 100 µL

CD2 (LFA2/600), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF647 conjugate, 0.1mg/mL
BNC470872-100 1x 100 µL

Retinol Binding Protein-1 (RBP/872), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF640R conjugate, 0.1mg/mL
BNC400970-100 1x 100 µL

GLG1 (Golgi Complex) (GLG1/970), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details