Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Protein MgtC (mgtC)

This Recombinant Brucella abortus Protein MgtC (mgtC) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Protein MgtC

UniProt

Q2YIG0

Expression Region

1-238

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAVGAATFVVFSSLVSGDS SPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAAVGVLCGAGLISHAAVATV FIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDAEAQVRALLLRDIGDHLHIHE LESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLEPRITSARWRIEDDSGGLSGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: 4C9]
AM26643AF-N 100 µg

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: 4C9]

Sign In for Pricing
View Details
13-O-Acetyl Papaveroxine
TRC-A187575-10MG 10 mg

13-O-Acetyl Papaveroxine

Sign In for Pricing
View Details
N-Boc-3-ethyl L-Norvaline
TRC-B655400-50MG 50 mg

N-Boc-3-ethyl L-Norvaline

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 500 reactions
PR2120-H-500 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 500 reactions

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UT-01 25 µg

Elab Fluor® Violet 610 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UT-02 100 µg

Elab Fluor® Violet 610 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details