Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3K1K0

Expression Region

1-238

Origin

Streptococcus agalactiae serotype Ia

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESTSNPTVSFLGIDFDLTILAMSLLTITIIFILVFWASRKMTIKPKGKQNVLEYVYELV NNTISQNLGHYTKNYSLLMFILFSFVFIANNLGLMTSLKTHEHNFWTSPTANFGVDITLS LLVAFICHIEGIRKKGIGGYLKGFLSPTPAMLPMNLLEEVTNVASLALRLFGNIFSGEVV TGLLLQLAVLSPFTGPLAFALNIVWTAFSMFIGFIQAYVFIILSSSYIGHKVHGDEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metazachlor Oxalic Acid-d6
TRC-M226232-1MG 1 mg

Metazachlor Oxalic Acid-d6

Sign In for Pricing
View Details
THBS1 ELISA Kit (Human) : 96 Wells (OKEH02928)
OKEH02928 96 Well

THBS1 ELISA Kit (Human) : 96 Wells (OKEH02928)

Sign In for Pricing
View Details
Human SERPINF2/Alpha-2-antiplasmin ELISA Kit
E2264Hu 96 Tests

Human SERPINF2/Alpha-2-antiplasmin ELISA Kit

Sign In for Pricing
View Details
P53 (pS15) Antibody
E38PA2184 100 µL

P53 (pS15) Antibody

Sign In for Pricing
View Details
Anti-RELT/TNFRSF19L Antibody, Rabbit Polyclonal
MBS8103142-01 0.1 mL

Anti-RELT/TNFRSF19L Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RELT/TNFRSF19L Antibody, Rabbit Polyclonal
MBS8103142-02 5x 0.1 mL

Anti-RELT/TNFRSF19L Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details