Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus clausii ATP synthase subunit a (atpB)

This Recombinant Bacillus clausii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5WB72

Expression Region

1-238

Origin

Bacillus clausii (strain KSM-K16)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEHHQYQFEFMGLLFNGTTMITTTIAMAIVVIITVIGCRKLAMRPTGLQNFIEWVVDFC RGIIKANMDWKVGGRFIVLAYALLFYVFVANMMGIPFELVTKEGHNVFWKSPTSDPVLTL TMAVFIVVLTHIYGIMVTGPSTYGKSWFTPKWFLFPFKVIEEGSNALTLGMRLFGNIYAK EILMLLLVSLGTTAVYWGIFAFVPLIVWQAFSIFIGSLQAYIFAMLAMVYMSHKVEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 Antibody
KC-096-01 50 μL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-096-02 100 µL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-096-03 1 mL

PGP9.5 Antibody

Sign In for Pricing
View Details
Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)
KN200395RB 1 Kit

Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF4B (NM_001417) Human Over-expression Lysate
LC419945 20 µg

EIF4B (NM_001417) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rTP53/1739), CF647 conjugate, 0.1mg/mL
BNC472091-100 1x 100 µL

P53 Tumor Suppressor Protein (rTP53/1739), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details