Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-4 (TSPAN4)

This Recombinant Pongo abelii Tetraspanin-4 (TSPAN4) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Tetraspanin-4, Tspan-4

UniProt

Q5RAP3

Expression Region

1-238

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQRDLK KGLHLYGTQGNVGLTNAWTIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT4 Polyclonal Antibody
E-AB-14373-01 20 µL

SYT4 Polyclonal Antibody

Sign In for Pricing
View Details
SYT4 Polyclonal Antibody
E-AB-14373-02 60 µL

SYT4 Polyclonal Antibody

Sign In for Pricing
View Details
SYT4 Polyclonal Antibody
E-AB-14373-03 120 µL

SYT4 Polyclonal Antibody

Sign In for Pricing
View Details
SYT4 Polyclonal Antibody
E-AB-14373-04 200 µL

SYT4 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS703635 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Human PLEKHG4B activation kit by CRISPRa
GA115863 1 Kit

Human PLEKHG4B activation kit by CRISPRa

Sign In for Pricing
View Details