Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-4 (TSPAN4)

This Recombinant Pongo abelii Tetraspanin-4 (TSPAN4) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Tetraspanin-4, Tspan-4

UniProt

Q5RAP3

Expression Region

1-238

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQRDLK KGLHLYGTQGNVGLTNAWTIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5'-Xanthylic Acid Triethylammonium Salt
TRC-X743805-10MG 10 mg

5'-Xanthylic Acid Triethylammonium Salt

Sign In for Pricing
View Details
FAM-LEHD-FMK Caspase 9 Detection Kit
FAM400-2 100 Tests

FAM-LEHD-FMK Caspase 9 Detection Kit

Sign In for Pricing
View Details
PFKFB2 (N-term) Rabbit Polyclonal Antibody
AP15138PU-N 400 µL

PFKFB2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACAT1 (C-term) Rabbit Polyclonal Antibody
AP14202PU-N 400 µL

ACAT1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Mouse Monoclonal Antibody [Clone ID: OTI1D4D1]
CF812554 100 µg

CD27 Mouse Monoclonal Antibody [Clone ID: OTI1D4D1]

Sign In for Pricing
View Details
Tissue Total RNA, Small intestine
CR562215 5 µg

Tissue Total RNA, Small intestine

Sign In for Pricing
View Details