Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7CND5

Expression Region

1-238

Origin

Streptococcus pyogenes serotype M18

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFV DGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLA LSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEV VTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFTKLTATYLGKKVNESEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS16 antibody
70R-1260 100 µL

RGS16 antibody

Sign In for Pricing
View Details
NPD014 Rabbit pAb, Pacific Blue conjugated
orb2881316 100 µL

NPD014 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Lentiviral human SEC14L1 shRNA (UAS) - Lentiviral human SEC14L1 shRNA (UAS) (25)
GTR15339404 1 Vial

Lentiviral human SEC14L1 shRNA (UAS) - Lentiviral human SEC14L1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Fmoc-D- (4-pyridyl) alanine
450462-01 100 mg

Fmoc-D- (4-pyridyl) alanine

Sign In for Pricing
View Details
Fmoc-D- (4-pyridyl) alanine
450462-02 250 mg

Fmoc-D- (4-pyridyl) alanine

Sign In for Pricing
View Details
Human Tim-1 protein
orb867432-01 50 µg

Human Tim-1 protein

Sign In for Pricing
View Details