Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Membrane protein insertase YidC 2 (yidC2)

This Recombinant Bacillus cereus Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 21-258.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q814F4

Expression Region

21-258

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSETGQPITSKSTGIWNEYFVYPLSQLITYFADLFNSNYGLAIVITTLIIRFALLPLMIK QTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMP ILFAFYHAIMRTAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNPQM AMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEIKASKAGKAGGSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT Antibody
KC-13625-01 50 μL

LAT Antibody

Sign In for Pricing
View Details
LAT Antibody
KC-13625-02 100 µL

LAT Antibody

Sign In for Pricing
View Details
LAT Antibody
KC-13625-03 1 mL

LAT Antibody

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-01 50 μL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-02 100 µL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-03 1 mL

SARNP Antibody

Sign In for Pricing
View Details