Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichyldiphosphatase 1 (DOLPP1)

This Recombinant Human Dolichyldiphosphatase 1 (DOLPP1) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Dolichyldiphosphatase 1, EC= 3.6.1.43, Dolichyl pyrophosphate phosphatase 1

UniProt

Q86YN1

Expression Region

1-238

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWF IFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP4 (ABCC4) (70-82) Goat Polyclonal Antibody
AP23671PU-N 100 µg

MRP4 (ABCC4) (70-82) Goat Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG5 (NM_001042665) Human Over-expression Lysate
LY421017 100 µg

PLEKHG5 (NM_001042665) Human Over-expression Lysate

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-1903
BSFT-1903 1 Unit

Floor Standing Shaking Incubator BSFT-1903

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF647 conjugate, 0.1mg/mL
BNC470502-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Isobutyryl-N-phenyl-3-phenylacrylamide (E/Z mixture)
TRC-I781040-1G 1 g

2-Isobutyryl-N-phenyl-3-phenylacrylamide (E/Z mixture)

Sign In for Pricing
View Details
SMARCB1 Polyclonal Antibody
E-AB-11593-01 20 µL

SMARCB1 Polyclonal Antibody

Sign In for Pricing
View Details