Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichyldiphosphatase 1 (DOLPP1)

This Recombinant Human Dolichyldiphosphatase 1 (DOLPP1) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Dolichyldiphosphatase 1, EC= 3.6.1.43, Dolichyl pyrophosphate phosphatase 1

UniProt

Q86YN1

Expression Region

1-238

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWF IFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit
E-EL-M0771-01 24 Tests

Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit
E-EL-M0771-02 48 Tests

Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit
E-EL-M0771-03 96 Tests

Mouse MIF (Macrophage Migration Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
NAP1L2 Polyclonal Antibody
E-AB-90340-01 60 µL

NAP1L2 Polyclonal Antibody

Sign In for Pricing
View Details
NAP1L2 Polyclonal Antibody
E-AB-90340-02 120 µL

NAP1L2 Polyclonal Antibody

Sign In for Pricing
View Details
NAP1L2 Polyclonal Antibody
E-AB-90340-03 200 µL

NAP1L2 Polyclonal Antibody

Sign In for Pricing
View Details