Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8E077

Expression Region

1-238

Origin

Streptococcus agalactiae serotype V

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESTSNPTVSFLGIDFDLTILAMSLLTITIIFILVFWASRKMTIKPKGKQNVLEYVYELV NNTISQNLGHYTKNYSLLMFILFSFVFIANNLGLMTSLKTHEHNFWTSPTANFGVDITLS LLVAFICHIEGIRKKGIGGYLKGFLSPTPAMLPMNLLEEVTNVASLALRLFGNIFSGEVV TGLLLQLAVLSPFTGPLAFALNIVWTAFSMFIGFIQAYVFIILSSSYIGHKVHGDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF640R conjugate, 0.1mg/mL
BNC403338-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDE6C Antibody (Biotin)
KB-26344-01 50 μL

PDE6C Antibody (Biotin)

Sign In for Pricing
View Details
PDE6C Antibody (Biotin)
KB-26344-02 100 µL

PDE6C Antibody (Biotin)

Sign In for Pricing
View Details
PDE6C Antibody (Biotin)
KB-26344-03 1 mL

PDE6C Antibody (Biotin)

Sign In for Pricing
View Details
5-(3'-Hydroxybenzylidene)hydantoin
TRC-H829630-10G 10 g

5-(3'-Hydroxybenzylidene)hydantoin

Sign In for Pricing
View Details
Caveolin-1 (Ab-14) Antibody
8B7034-AAT 50 µg

Caveolin-1 (Ab-14) Antibody

Sign In for Pricing
View Details