Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8E5V3

Expression Region

1-238

Origin

Streptococcus agalactiae serotype III

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESTSNPTVSFLGIDFDLTILAMSLLTITIIFILVFWASRKMTIKPKGKQNVLEYVYELV NNTISQNLGHYTKNYSLLMFILFSFVFVANNLGLMTSLKTHEHNFWTSPTANFGVDITLS LLVAFICHIEGIRKKGIGGYLKGFLSPTPAMLPMNLLEEVTNVASLALRLFGNIFSGEVV TGLLLQLAVLSPFTGPLAFALNIVWTAFSMFIGFIQAYVFIILSSSYIGHKVHGDEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PX-13-17OH
471201 5.0mg

PX-13-17OH

Sign In for Pricing
View Details
Anti-NRF1  (2F9)
YF-MA14517 100 ug

Anti-NRF1 (2F9)

Sign In for Pricing
View Details
Recombinant Human CD28 Protein, Fc Tag
E40KMH183 20 µg

Recombinant Human CD28 Protein, Fc Tag

Sign In for Pricing
View Details
Lentiviral mouse Piezo1 shRNA (UAS) - Lentiviral mouse Piezo1 shRNA (UAS) plasmid
GTR15211591 1 Vial

Lentiviral mouse Piezo1 shRNA (UAS) - Lentiviral mouse Piezo1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
TBX1 Antibody (C-term)
orb1927949-01 50 µL

TBX1 Antibody (C-term)

Sign In for Pricing
View Details
TBX1 Antibody (C-term)
orb1927949-02 100 µL

TBX1 Antibody (C-term)

Sign In for Pricing
View Details