Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Protein MgtC (mgtC)

This Recombinant Brucella melitensis biotype 1 Protein MgtC (mgtC) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Protein MgtC

UniProt

Q8YDX1

Expression Region

1-238

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAVGAATFVVFSSLVSGDS SPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAAVGVLCGAGLISHAAVATV FIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDAEAQVRALLLRDIGDHLHIHE LESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLEPRITSARWRIEDDSGGLSGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ibuprofen Ethyl Ester
TRC-I140080-1G 1 g

Ibuprofen Ethyl Ester

Sign In for Pricing
View Details
LGR6 Antibody
8G376-AAT 50 µg

LGR6 Antibody

Sign In for Pricing
View Details
WBP1 Rabbit Polyclonal Antibody
TA369744 100 µL

WBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rnf138 Antibody
KC-43389-01 50 μL

Rnf138 Antibody

Sign In for Pricing
View Details
Rnf138 Antibody
KC-43389-02 100 µL

Rnf138 Antibody

Sign In for Pricing
View Details
Rnf138 Antibody
KC-43389-03 1 mL

Rnf138 Antibody

Sign In for Pricing
View Details