Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Sarcospan (SSPN)

This Recombinant Rabbit Sarcospan (SSPN) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Sarcospan

UniProt

P82352

Expression Region

1-238

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKDRQPRGQQRQGDAAGPDDPGPKKGAGTREQRGEEEAQTCCGCRFPLLLALLQLALGV AVTVVGFLMASVSSSLLVRATPYWAGIIVCVVAYLGLFMLCVSYQVDERTCIQFSMKLLY FVLSALGLVVCVLAVAFAAHHYSLLTHLTCENAPDSCQCKLPSSEPLSRTFVYRDVTDCT SITGTFQVFLLVQMVLNLVCGLVCLVACFVMWKHRYQVFYVGVRMCPLSASEGQQQKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF16, NT (ARHGEF16, EPHEXIN4, NBR, Rho guanine nucleotide exchange factor 16, Ephexin-4) (Azide free) (HRP) discontinued
032048-HRP 200 µL

ARHGEF16, NT (ARHGEF16, EPHEXIN4, NBR, Rho guanine nucleotide exchange factor 16, Ephexin-4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
NAPRT1 (Nicotinate Phosphoribosyltransferase, NAPRTase, FHA-HIT-interacting Protein, Nicotinate Phosphoribosyltransferase Domain-containing Protein 1, FHIP, PP3856) (MaxLight 650)
130144-ML650 100 µL

NAPRT1 (Nicotinate Phosphoribosyltransferase, NAPRTase, FHA-HIT-interacting Protein, Nicotinate Phosphoribosyltransferase Domain-containing Protein 1, FHIP, PP3856) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Ankrd61 shRNA (UAS) - Lentiviral mouse Ankrd61 shRNA (UAS, RFP) (25)
GTR15285791 1 Vial

Lentiviral mouse Ankrd61 shRNA (UAS) - Lentiviral mouse Ankrd61 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-Membrane primary amine oxidase AOC3 Antibody
A02851 100 µL

Anti-Membrane primary amine oxidase AOC3 Antibody

Sign In for Pricing
View Details
Neurotrophin 4 Rabbit pAb
APA3358-01 30 µL

Neurotrophin 4 Rabbit pAb

Sign In for Pricing
View Details
Neurotrophin 4 Rabbit pAb
APA3358-02 50 μL

Neurotrophin 4 Rabbit pAb

Sign In for Pricing
View Details