Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus PS3 ATP synthase subunit a (atpB)

This Recombinant Bacillus PS3 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P09218

Expression Region

1-238

Origin

Bacillus PS3 (Thermophilic bacterium PS-3)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHKAPLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVR GIINSTMDWQTGGRFLTLGVTLIMYVFVANMLGLPFSVHVNGELWWKSPTADATVTLTLA VMVVALTHYYGVKMKGASDYLRDYTRPVAWLFPLKIIEEFANTLTLGLRLFGNIYAGEIL LGLLASLGTHYGVLGAVGASQFPIMVWQAFSIFVGTIQAFIFTMLTMVYMAHKVSHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Der f 1 Protein
abx620830-01 100 µg

Der f 1 Protein

Sign In for Pricing
View Details
Der f 1 Protein
abx620830-02 1 mg

Der f 1 Protein

Sign In for Pricing
View Details
Nitric Oxide Synthase Trafficker (NOSTRIN) Antibody
abx002554-01 100 µL

Nitric Oxide Synthase Trafficker (NOSTRIN) Antibody

Sign In for Pricing
View Details
Nitric Oxide Synthase Trafficker (NOSTRIN) Antibody
abx002554-02 200 µL

Nitric Oxide Synthase Trafficker (NOSTRIN) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Adenovirus-9 E4 Orf1 Antibody [FITC]
NBP2-41088F 0.1 mL

Rabbit Polyclonal Adenovirus-9 E4 Orf1 Antibody [FITC]

Sign In for Pricing
View Details
IL22RA2 Recombinant Protein
OPCD04385-50UG 50 µg

IL22RA2 Recombinant Protein

Sign In for Pricing
View Details