Recombinant Bacillus PS3 ATP synthase subunit a (atpB)
This Recombinant Bacillus PS3 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
P09218
Expression Region
1-238
Origin
Bacillus PS3 (Thermophilic bacterium PS-3)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEHKAPLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVR GIINSTMDWQTGGRFLTLGVTLIMYVFVANMLGLPFSVHVNGELWWKSPTADATVTLTLA VMVVALTHYYGVKMKGASDYLRDYTRPVAWLFPLKIIEEFANTLTLGLRLFGNIYAGEIL LGLLASLGTHYGVLGAVGASQFPIMVWQAFSIFVGTIQAFIFTMLTMVYMAHKVSHDH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
104200C1-AAT 500 Tests
IFluor® 594 Anti-human CD42b Antibody *HIP1*
Sign In for Pricing
View Details 
GTR10458952 96 Well
Porcine Calcineurin like phosphoesterase domain containing protein 1 (CPPED1) ELISA kit
Sign In for Pricing
View Details 
N001809 505 Roll (505 Marker (s) x 1 Roll)
NITR.DESOD.127X33RL-T2-P21 Pipe Markers for Acids & Bases
Sign In for Pricing
View Details AMM20812V 100 µL
CD272 (BTLA) Mouse Monoclonal Antibody [Clone ID: LBI8B6]
Sign In for Pricing
View Details MBS9020034-01 0.02 mg (E-Coli)
Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)
Sign In for Pricing
View Details