Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB)

This Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P0A2Y9

Expression Region

1-238

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFV IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clic4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4737307 1.0 µg DNA

Clic4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
KDR Antibody
orb675554-01 50 µg

KDR Antibody

Sign In for Pricing
View Details
KDR Antibody
orb675554-02 100 µg

KDR Antibody

Sign In for Pricing
View Details
ZFAND2B Rabbit Polyclonal Antibody
orb186669-01 50 μL

ZFAND2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND2B Rabbit Polyclonal Antibody
orb186669-02 100 µL

ZFAND2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND2B Rabbit Polyclonal Antibody
orb186669-03 200 µL

ZFAND2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details