Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus sanguinis ATP synthase subunit a (atpB)

This Recombinant Streptococcus sanguinis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A3CM09

Expression Region

1-238

Origin

Streptococcus sanguinis (strain SK36)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESINPTINIGPVTFDLTLLAMTLLTVFVTFGLVYWASRKMTIKPSRKQNALEYIYDFV IDFTKGNVGEHYMKNYSLFLFSLFLFVAVANNLGLMAKVQTTNGFNLWTSPTANLAFDLG FSLLVTVFCHVEGIRRQGIKGYLKGFVTPGIMTPMNILEEFTNFASLALRIYGNIFAGEV LAGLLLTWAHQAAYWYPIAFIMNMVWTGFSIFISCIQAYVFTMLTSMYLGKKINGEVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dpp4 activation kit by CRISPRa
GA201121 1 Kit

Mouse Dpp4 activation kit by CRISPRa

Sign In for Pricing
View Details
PKC nu (PRKD3) (NM_005813) Human Recombinant Protein
TP762053 50 µg

PKC nu (PRKD3) (NM_005813) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-90442-01 60 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-90442-02 120 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-90442-03 200 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), Biotin conjugate, 0.1mg/mL
BNCB2037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details