Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB)

This Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B8ZLB4

Expression Region

1-238

Origin

Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFV IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCC Antibody
C49170-01 50 μL

TBCC Antibody

Sign In for Pricing
View Details
TBCC Antibody
C49170-02 100 µL

TBCC Antibody

Sign In for Pricing
View Details
Bcl-xL, Recombinant, Human, His-Tag, aa1-212
B0807-16R1 100 µg

Bcl-xL, Recombinant, Human, His-Tag, aa1-212

Sign In for Pricing
View Details
Recombinant Human SHH Protein, N-His
bs-102043P-01 20 µg

Recombinant Human SHH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SHH Protein, N-His
bs-102043P-02 50 µg

Recombinant Human SHH Protein, N-His

Sign In for Pricing
View Details
SDHAF2 (NM_017841) Human Tagged ORF Clone
RC201437 10 µg

SDHAF2 (NM_017841) Human Tagged ORF Clone

Sign In for Pricing
View Details